PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_39946
Common NameKK1_036986
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 550aa    MW: 60251.8 Da    PI: 4.9228
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_39946genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.23.8e-184390148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed++lvd+vk++G g+W+++ ++ g+ R++k+c++rw ++l
    C.cajan_39946 43 KGPWTSTEDDILVDYVKKHGEGNWNAVQKHTGLLRCGKSCRLRWANHL 90
                     79******************************99**********9986 PP

2Myb_DNA-binding513.3e-1696139146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+ l++++++++G++ W++ a++++ gRt++++k++w++
    C.cajan_39946  96 KGAFTAEEERLIAELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 139
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.0863890IPR017930Myb domain
SMARTSM007178.4E-154292IPR001005SANT/Myb domain
SuperFamilySSF466897.86E-3042137IPR009057Homeodomain-like
PfamPF002493.8E-164390IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-234497IPR009057Homeodomain-like
CDDcd001671.27E-114590No hitNo description
PROSITE profilePS5129425.06791145IPR017930Myb domain
SMARTSM007172.2E-1695143IPR001005SANT/Myb domain
PfamPF002492.9E-1596139IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-2598144IPR009057Homeodomain-like
CDDcd001678.17E-1298139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 550 aa     Download sequence    Send to blast
MRRLKNDINE DEVLPNDQTG AQLNGAQLND EGSEGSAGVV LKKGPWTSTE DDILVDYVKK  60
HGEGNWNAVQ KHTGLLRCGK SCRLRWANHL RPNLKKGAFT AEEERLIAEL HAKMGNKWAR  120
MAAHLPGRTD NEIKNYWNTR IKRRQRAGLP LYPPEVCLQA LQESQHSQSS GGLNGDNKMH  180
PDFLQKNSYE IQDSIFDSLK DNQGIIPYMP ELSDISVYGN MLKGFDSSQY CSFVPPTSPK  240
HKRLRESTIP FIDSSDMSRN GLYPFDQIRD NNSDEIAQSF GMPAPLDPGP SSHSSICYSH  300
SLSNGNSSTS KPTYEAVKLE LPSLQYPELD LGSWGTSPPP SLLESVDDFI QSPTPISTLE  360
SDCSSPQNSG LLDALLYQAR TLSSSKNHCS DKSSNSSTAT PGDRADSSAL NVHETEWEDY  420
ADPVSPFGAT SILNECPALN ANANSLDKQL PVQTFNGDIL KLESVDEVWT PNGENQTLSL  480
LNITRPDFLL ASDWPDLSSG HGKNLAFTMD ATTTLGLGDD LATDHKHVTA GTSKSSQMWG  540
FGSCATAMIG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-32411445107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5258970.0KC525897.1 Glycine max GAMBY1-like family protein (GAMYB1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001304541.10.0transcription factor GAMYB-like
TrEMBLA0A151RGG10.0A0A151RGG1_CAJCA; Transcription factor GAMYB
STRINGGLYMA13G25716.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-111myb domain protein 33